GenomeNet

>ses:SARI_00607 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) hypothetical protein (A)
MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDMLSALPDGQPVTEI
TAGLDTLCRQAPEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLR
STWLSSPEVPVWPLFAQRICVVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDILR
DNPTEFRAVNIARLLDNEEKWPLLYDALSPMATNCDMIIMPACFGLANDTLWRWLNERLS
CALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVKKVTCRHGIVSEIWTRNHADI
PLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQNFFDPQPWQQFGV
VTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAQGCGGGVCAVSALQAAHHIAERAGEQQ

BLAST