GenomeNet

>ses:SARI_01104 hypothetical protein; K03587 cell division protein FtsI (penicillin-binding protein 3) (A)
MKKKSGGDTRNFTPIRFALLCTAILLSMALLLGRVAWLQIVTPSKLVKQEDMRSLREVTT
ASPRGMITDREGRPLAVSVPVNAVWADPKTIISKGGVGYNQRWQALASALHLSLSTLAER
VNSNPAGRFIYLARQVSPQQAEWIDKLNLPGINLREESRRFYPAGHVAANLIGFTNIDGQ
GIEGVEKSFNAQLTGKPGSRLVRKDKFGHVIENITEVNPVPAHELQLSIDERLQTVTEDA
LDNAVIWNKADSGAAVLINIPTGEILSMASYPDFNPNNREGAQLDDFRNRAISDTFEPGS
TVKPLVIMTALQQGIVQPDSVIDTHPFILDGHRIRDVGYYPELTLTGILQKSSDTGVSHL
SLAMPVQKLMDTYKSFGFGVPTGLGLTGESSGLLPKRRYWSDLDRATFAFGYGLMVTPLQ
LAHVYATIGSFGIYRPLSITKVDPPVIGTRVMSEELVHEVEHMMESVALPGGGGTKAAVR
DYRIAVKTGTAKKIGDDGKYVDKYVAYTAGVAPASNPRFALVVVINNPQNGAYYGGAVSA
PVFSQIMGDVLRLENVEPDGMPADSDHLLVMHGNHVSVPGL

BLAST