GenomeNet

>ses:SARI_01104 K03587 cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4] | (GenBank) hypothetical protein (A)
MKKKSGGDTRNFTPIRFALLCTAILLSMALLLGRVAWLQIVTPSKLVKQEDMRSLREVTT
ASPRGMITDREGRPLAVSVPVNAVWADPKTIISKGGVGYNQRWQALASALHLSLSTLAER
VNSNPAGRFIYLARQVSPQQAEWIDKLNLPGINLREESRRFYPAGHVAANLIGFTNIDGQ
GIEGVEKSFNAQLTGKPGSRLVRKDKFGHVIENITEVNPVPAHELQLSIDERLQTVTEDA
LDNAVIWNKADSGAAVLINIPTGEILSMASYPDFNPNNREGAQLDDFRNRAISDTFEPGS
TVKPLVIMTALQQGIVQPDSVIDTHPFILDGHRIRDVGYYPELTLTGILQKSSDTGVSHL
SLAMPVQKLMDTYKSFGFGVPTGLGLTGESSGLLPKRRYWSDLDRATFAFGYGLMVTPLQ
LAHVYATIGSFGIYRPLSITKVDPPVIGTRVMSEELVHEVEHMMESVALPGGGGTKAAVR
DYRIAVKTGTAKKIGDDGKYVDKYVAYTAGVAPASNPRFALVVVINNPQNGAYYGGAVSA
PVFSQIMGDVLRLENVEPDGMPADSDHLLVMHGNHVSVPGL

BLAST