GenomeNet

>ses:SARI_01203 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) hypothetical protein (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGTGKISSRIGLSSPAK
LFNQNTSLFEEIRAENARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDF
RGELFVGSQYLLSWSDKLVELKTICFCGRKASMVLRLDQDGRPYNEGEQVVIGGNERYVS
VCRKHYKDSLEEGSLTEIQERHRHI

BLAST