GenomeNet

>ses:SARI_03976 K01805 xylose isomerase [EC:5.3.1.5] | (GenBank) hypothetical protein (A)
MELTMQAYFDQLDRVRYEGPQSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNG
ADMFGVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPEGASLKEYK
NNFAQMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPDVFSWAATQVVTAMNA
THKLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQ
EPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVD
ANRGDAQLGWDTDQFPISVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGH
IGAMDTMALSLKIAARMVEDGELDKRVAKRYAGWNGELGQQILKGQLSLGELAQYAEQHN
LAPVHQSGHQELLENLVNRYLFDK

BLAST