GenomeNet

>sesp:BN6_11270 Neuraminidase like protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MRLLVTVLALLLAGSSVAAASGVAPSTSSIGVEHVLFKSGTGGYGCYRIPALVRTASGAL
LAFAEGRRSPSCADRGDIDLVVRRSTNDGRTWSPTRVVLRGFGDNPFAPYTRGNPAPVVD
AQTGRVFLLSTSNPAVPGGERLPWVQHSDDDGLTWSTSRQIPASFAGSTRGWFATGPSHG
VQLRNGNLVVGAHQGVDGHVYAGVLYSTDHGDTWHASTTPDSLVEGKLNPGEMSVAELPN
GDVYVAGRNHIATGHHRTRAISKDGGASVSASTAIPTLTTPDVQGSVLALRSGTLLFAGP
SDPQDRKLMRIRHSTDNGVTWTAGGLVNGSRAGYSDLAELTTGEIGLLYEGGEKFSADEI
RFTRFTTQQAQVPGGTNPAGPATPAPGPTSPDVSPEANDAYVRGSVGGGLVGQADLPWTR
SLDVGADDFTVSFSFKHNGSTADQALFWAYGQGGSVPQVWLRVAKSGQVVAWVQGSGGGA
TTSVPGAFADGAWHQLTLTRQAGQVTLAVDAASTSATGVAGVVGQVGGRTGIRLGARLDG
ADPFTGTLKDFTLTRAGRVVADLPLVTVDGAATATRTTVAITDDLTGHCADGTLLGGHRV
PVAGKFGSALDVDSTHPGAEVPYLAALDPGGRDFTYSLWFQHKGGADQALLWAYGATAGK
PSVWVRAQPGSDRLYGWVQTDVGQVAVQVKDGTDAAAFGDGKWHQLVLRRVGDRVELSVD
GGAPAVATGLTGSVGGPLGVRVGSKPDGSDVLDGVLDDVKLDIAGVPVLRWGFDGQNTQA
HDVVRVPAGPGTPDGSQRCNHAAVRGGAATTAGAVGRGLAFDGVDDSVVVPYEPVDGADF
AVSTSFKYSGGGDQVLVWAYGVGATERALWLRAQPSKDRLLAWVQTDAGAFGVAAEDPSA
VAAFGDGKWHRAELRRTGDRLELSVDGVVSGRAEIRGSLNYSDGFAVDGFQLGARPDGAD
RFKGALDEFRVERGGATLVHLPFEVVSGREYVRG

BLAST