GenomeNet

>sesp:BN6_24580 DNA polymerase LigD, ligase domain-containing protein (A)
MTGLLPWSLGPTLKPIADNCRPRFGARVKNPFSAYAPPVDLPVMPPVRPMLAKAVREVPR
EPGLVYEPKWDGFRCVVFRDGDELELGSRNDRPLTRYFPEVADLLANGLPARCVVDGEVV
IVTPDGLSFDLLQLRLHPAASRVRKLAAETPASFVAFDLLALGDRDLTGVPFGERRALLA
EALTETPGLYLTPATDDPDVAQDWFTRFEGAGFDGVVAKRTDLPYEQDRRVMWKVKHERT
ADCVVAGYRTHKDGEGVGSLVLGLYDDEGTLHHVGVASSFTATRRRELVAELEPYRARAL
DDHPWGEWARLDAATPGAQSRWAPDKTLSWEPLRPELVAEVRYEHVQGTRFRHTARLVRF
RPDRTPDSCTYRQLEEVPPAELTEMFRP

BLAST