GenomeNet

>sesp:BN6_42910 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) putative DNA ligase (A)
MSGDLSEYRSKRVVGRTPEPLPAVEALLPRGSDDTFVIQEHHASSLHWDVRLERGGVLVS
WAVPKGLPAEPGTIRLAVRTEDHPVEYASFEGVIPKGEYGAGRMFVWDRGRYETVKWSDR
EVDVVLHGSRIEGEFVFFRRGSSGGGGSGRDWMVRRRHEAVRPDWVALPEWVEPMLATAA
SGLPARPEEFAFEFKWDGVRAVARVEGGRLRLVSRSGVDITAVYPELQGLGGALGSTQVL
LDGEVVAFAGGRPSFGALQQRLQASAAQARRLAARVPVTFLVFDVLHLDGASTVGLPYAR
RRELLEGLGLVGPHWLVPRAFPGAGAEVLAASREQGLEGVVAKRLDSRYVPGVRSAWWLK
ITDVAAQEVVIGGWRPGGGRRAGLVGSLLLGVPDGAGLVFVGSVGTGFGEAELPGLTERL
RGLEVSRSPFSSEVPRERARGARWVRPVLVGEVVHRQWTAEGRMRFPTWRGLRPDRVPEE
VRRGGGDGGAGR

BLAST