GenomeNet

>sev:STMMW_23101 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit C (A)
MSDTRFESCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCK
RCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFILSHTDLMGSVSTPFAPVVNTATALKP
VRQLLDYALKIDHRRTLPKYSFGTFRRWYRSVAAQQAKYKDQVAFFHGCFVNYNHPQLGK
DLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAISNVESLREAIAVKGIPVIAT
SSTCTFALRDEYPEVLDVDNAGLREHIELATRWLWRKLDAGKTLPLNPLPLKVVYHTPCH
MEKMGWTLYTLELLRQIPGLELTVLDSQCCGIAGTYGFKKENYPTSQSIGAPLFRQIEES
GADIVVTDCETCKWQIEMSTSKRCEHPITLLAQALG

BLAST