GenomeNet

>sew:SeSA_A1113 aspC; aromatic amino acid aminotransferase (EC:2.6.1.1); K00813 aspartate aminotransferase [EC:2.6.1.1] (A)
MFENITAAPADPILGLADLFRADDRPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE
TTKNYLGIDGIPEFARCTQELLFGKGSALINDKRARTAQTPGGTGALRIAADFLAKNTPV
KRVWVSNPSWPNHKSVFNAAGLEVREYAYYDAENHTLDFEALQASLSEAQAGDVVLFHGC
CHNPTGIDPTLEQWQVLAELSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAALHKELIV
ASSYSKNFGLYNERVGACTLVAADVETVDRAFSQMKSAIRANYSNPPAHGASIVATILSN
DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR
LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL

BLAST