GenomeNet

>sex:STBHUCCB_6200 anaerobic glycerol-3-phosphate dehydrogenase subunit A; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MKTRDSQASDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDGLAFQATFIRACEAAGIRAEA
IDPQQARIIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATVCGVHVRNHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPSDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTP
GWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI

BLAST