GenomeNet

>sey:SL1344_2254 glpB; anaerobic glycerol-3-phosphate dehydrogenase subunit B (EC:1.1.5.3); K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] (A)
MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDI
TAGLDALCRQAPEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLR
STWLSSPEVPVWPLSAQRICVVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLR
DNPTEFRAVNIARLLDNEEKWPLLYDALSPIATNCDMIIMPACFGLANDTLWRWLNERLP
CALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVKKVTCRRGTVSEIWTRNHADI
PLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFFDPQPWQQFGV
VTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ

BLAST