GenomeNet

>sey:SL1344_2254 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) glpB; Anaerobic glycerol-3-phosphate dehydrogenase subunit B (A)
MKFDTVIMGGGLAGLLCGLQLQQHGLRCAIVTRGQSALHFSSGSLDLLSALPDGQPVTDI
TAGLDALCRQAPEHPYSRLGAQKVLTLAQQAQTLLNASGAQLYGDVQQAHQRVTPLGTLR
STWLSSPEVPVWPLSAQRICVVGVSGLLDFQAHLAAASLRQRDLNVETAEIDLPELDVLR
DNPTEFRAVNIARLLDNEEKWPLLYDALSPIATNCDMIIMPACFGLANDTLWRWLNERLP
CALTLLPTLPPSVLGIRLHNQLQRQFVRQGGIWMPGDEVKKVTCRRGTVSEIWTRNHADI
PLRPRFAVLASGSFFSSGLVAEREGIREPILGLDVQQTATRAEWYQQHFFDPQPWQQFGV
VTDDAFRPSLAGNTVENLYAIGSVLAGFDPIAEGCGGGVCAVSALQAAHHIAERAGEQQ

BLAST