GenomeNet

>sfd:USDA257_c18040 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) acoC2; dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (A)
MSSIEAVTVPKWGMTMTEGKITQWMVGEGEHVTRGQEILEIETTKVTNVVEAAATGTLRR
IVLKEGTTAPVGALAGVIAEAAATSEEIDAFIASYADRLGAGDEGDGGVPVPRTIAVDGG
AVNVLEAGPQGDETVVLLHGFGGDLSTWLFNQSALAENMRVVAIDLPGHGASSPIAGGDV
FPKIVSAVEAAVEAVAPGKLHLIAHSFGGAVAAAIAANRPSRVGSLTLIAPIGLSRQISR
DFLVDFVAAERRRPLLGVLERLFADPSKITSDMVEGTLRFKRLEGVPEALSAIADTIADD
NGQLQSIGDQLQALTCPVTLIWGERDGIVPVPQQAEVPGNVQLRIIPGAGHMPQMEASSA
VNEAIMENIQRSSGI

BLAST