GenomeNet

>sfd:USDA257_c23120 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) putative ribulose bisphosphate carboxylase-like protein (A)
MIRITYRIETPGDVVALAAKIASDQSTGTFVPVPGETEELKARVAARVVAIRNLEPTDRP
SWPEEAGEAKRFNRADADIEFPLDAVGTDLAALMTIAIGGVYSVKGMTGVRVVDMKLPPE
FCAAHPGPQFGVAGSRRLTGVEEGPIIGTIVKPALGLRPEETGELVGELLSSGVDFIKDD
EKLMSPVYSPLKERIAAIMPRILNHEQKTGKKVMYAFGISHTDPDEMMRNHDHVVQAGGN
AGVVNINSIGMGGLGFLRKRSGIVLHAHRNGWDILTRHGGLGMEFSVWQQFWRLIGVDQF
QINGIRVKYWEPDESFVKSFKAVSTPLLSERDCPLPVVGSGQWGGQAPETYARTGGSTDL
LYLCGGGIVSHPGGAGAGVRAVRHAWEAAVAGIPLADYAKDHPELAQSLVKFADGKGT

BLAST