GenomeNet

>sfd:USDA257_c52060 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ykoU3; putative ATP-dependent DNA ligase YkoU (A)
MAARSEPLSEYNRRRDFSKTREPKGAVARTHPGQKRFLVQKHDATRLHYDFRLEWEGVLK
SWAVTRGPSLNPEDKRLAIRTEDHPLAYGDFEGTIPEGEYGGGTVMLWDTGWWEPEDDPE
KGLKKGKLAFRLHGSRMKGGWALVRMRPRDGEKRESWLLVKQDDDVASEDGESLIKQHVV
SARTGRTMDEIAEGRGEKRARVWHSNKSTAANLNAGAVSQDEGRSKRRARKSSVKPPAFR
PPQLATLVTKAPAGDDWLNEAKFDGYRLIAAVGGGIARCYTRNGLDWTEKFPTIAAALAE
LDCDSALIDGEVVALADQGSNFSALQKALRTGASMRFYAFDLIELDEKDLSRRPLVERKE
KLAALLDSLGTTATIQYSEHVRGNGEHILAAICKAGQEGIIAKEAKAPYRSGRTRSWLKV
KCTKRQEFVIGGYTPSTKKGRAFASLLLGTFEGGKLIYRGGVGTGFGEKVMEELAAAFAK
RQRPTSPFDQVPRERSRDAVWLKPDLVAEVDFAEFTADGHIRHGSFEGLREDREAKTVKL
ETAKPTDAEPGAAKGKSSAKTRTASPTKGDADILGVHISHPDRILFEGQGITKIDLARYY
AVVAERMLPFAADHPVSLVRCPQGGQRQCFFQKHANEGFPEAIREVPITESSGETENYMY
VHDAKGLVAAVQMGTLEFHIWGATIDRLEKPDRLVFDLDPDPSVDFATVKAAATTLRDEL
AEIGLKTVAMVTGGKGVHVIVPLRPHAEWDEAKGFAKRLAQTFAERDPEHFVATMSKAKR
KGRIFIDWLRNDRGATAIAPYSTRARAGGPVATPVSWDELEALDAANTFHIADIIERIEA
GTDPWREIGEIKQSLTKKMLNSTIS

BLAST