GenomeNet

>sfd:USDA257_c61520 glutathione S-transferase protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTAPLTLISHHLCPYVQRAATALHEKGIPFERAFIDLANKPDWFLQISPLGKVPLLRIPQ
EEGEAILFESTVICEYLEETQGGAKLHPADPLTRARHRGWIEFGSSVLADLWVYETTQDG
ETLEAKRNTLKTKFSTVEAELGDGPYFAGADFSLVDAVFAPIFRYFDVFDSIAEHGIFDG
LPRVSAWRKALAARPSVKAAVTDDYAERLMAFLRKHDAALLKTGKIAA

BLAST