GenomeNet

>sfe:SFxv_2566 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) glpC; Sn-glycerol-3-phosphate dehydrogenase (Anaerobic), K-small subunit (A)
MNDTSFENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCK
RCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFVLSHTDLMGSVSTPFAPIVNTATSLKP
VRQLLDAALKIDHRRTLPKYSFGTFRRWYRSIAAQQAQYKDQVAFFHGCFVNYNHPQLGK
DLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAITNVESIREAVGVKGIPVIAT
SSTCTFALRDEYPEVLNVDNKGLRDHIELATRWLWRKLDEGKTLPLKPLPLKVVYHTPCH
MEKMGWTLYTLELLRNIPGLELTVLDSQCCGIAGTYGFKKENYPTSQAIGAPLFRQIEES
GADLVVTDCETCKWQIEMSTSLRCEHPITLLAQALA

BLAST