GenomeNet

>sfh:SFHH103_00741 gst7; glutathione S-transferase family protein (EC:2.5.1.18); K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MTAPIELYYWPTPNGWKITIMLEELDVPYVVKYINIGRGDQFAPDFLKIAPNNRMPAIVD
PDGPGGAPISIFESGAILQYLGRKYGKFYPADERARVEVEQWLFWQVGGLGPMAGQAHHF
RQYAPERIQYGIDRYTNEVNRLYGVMNKRLADRPFLAGDYSIADMAAIGWVIPHENQGQD
LDEFPNLKRWFETMLARPAVQKGIEVGKEERARQKSLAEDQEAQKILFGQRAR

BLAST