GenomeNet

>sfh:SFHH103_00741 K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] | (GenBank) gst7; glutathione S-transferase family protein (A)
MTAPIELYYWPTPNGWKITIMLEELDVPYVVKYINIGRGDQFAPDFLKIAPNNRMPAIVD
PDGPGGAPISIFESGAILQYLGRKYGKFYPADERARVEVEQWLFWQVGGLGPMAGQAHHF
RQYAPERIQYGIDRYTNEVNRLYGVMNKRLADRPFLAGDYSIADMAAIGWVIPHENQGQD
LDEFPNLKRWFETMLARPAVQKGIEVGKEERARQKSLAEDQEAQKILFGQRAR

BLAST