GenomeNet

>sfh:SFHH103_02234 tdk; hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGTGRIASRIGLKSDGI
PFHGGDDLYGLIERLNDDGSGEIACVFVDEAQFLDEDQVWQLARVADRLGIPVMAYGLRT
DFQGKLFPGSMALLALADELREVRTICHCGRKATMVVRLDGDGNVVREGAQVDVGGNEKY
VSYCRRHWEDRMRDG

BLAST