GenomeNet

>sfh:SFHH103_02797 putative ATP-dependent DNA ligase protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAARSEPLSEYNRRRDFTKTREPKGAVARTHAGRKRFLVQKHDATRLHYDFRLEWEGVLK
SWAVTRGPSLNPEDKRLAIRTEDHPLAYGDFEGTIPEGEYGGGTVMLWDTGWWEPEGDPS
KGLKKGKLSFKLHGSRMKGGWALVRMRPRDGEKRENWLLVKETDEIASEDGENLIKENIT
SVVTGRAMDEIAGGKGEKRARFWHSNKSTAANLKAGAIAENDNARRRSARRPSGKLPAFK
APQLATLVTKAPAGETWLNEAKFDGYRLLCAIGGGTVRCYTRNGLDWTEKFPAIAAALAE
LDCKSALIDGEVVALSDAGPSFSALQKALRTGASTRLYAFDLIELDGKDLSREPLIERKE
KLKLLLGSLGTTATVQYSEHVEGNGEHVLAAICKAGQEGIIAKEAKAPYRSGRTRSWLKV
KCTRRQEFVIGGYTPSSKKGRPFASILVGTFEGGKLIYRGGVGTGFGEKVMQELAAAFAS
RSRETPPFDSVPRERMRNAVWLKPDLVAEVDFAEFTADGHVRHGSFEGMREDKEAKAVKL
ETAKPTGAAPGAAKSKPSAKTSKASSAKGDTDVLGIHISHPDRILFQGQGITKIDLARYY
AVVAERMLPFTADHPVSLVRCPQGGQRHCFYQKHASDGFPDEIKEVPIEESSGSTENYMY
VRHAKGLVAAVQMGTLEFHIWGATIDKLETPDRLVFDFDPDPSVDFTTVKNAAVALRDEL
ADIGLQSFALVTGGKGVHVVVPLVRRASWDDAKSFAKAVAQNIADRDPDHFVATMSKAKR
KGRIFIDWLRNERGATAIAPYSSRAREGGPIATPVGWDEMERLSGANTFHIGDILERIEA
DTDPWRDIGKVKQSLTKKMMDSVAK

BLAST