GenomeNet

>sfh:SFHH103_02958 xylA; protein XylA; K01805 xylose isomerase [EC:5.3.1.5] (A)
MSTGFFGDIAKIKYEGLESTNPLAFRHYNPDEVVLGKRMEDHLRFAVAYWHTFVWPGGDP
FGGQTFERPWFKDTMDAAKLKADVAFEFFQLLGVPFYCFHDADVRPEGRNFAENTSNLNE
IVDHFAEKQAETGVKLLWGTANLFSNRRYMGGAATNPDPDVFAFAAATVKTCIDATQRLG
GENYVLWGGREGYETLLNTDLKRELDQLGRFVNLVVEYKHKIGFKGAILIEPKPQEPTKH
QYDFDVATVYGFLKKYGLENEVKVNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLSGGGFKSGGTNFDAKLRRQSIDPEDLLIGHIGGMD
CCARGLKAAAKMVEDKALSGPLEKRYAGWNVPEAKKMLDGGFSLEEIEAWVRKADLNPQA
KSGKQEYLENVVNRYV

BLAST