GenomeNet

>sfh:SFHH103_03898 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst4; glutathione S-transferase family protein (EC:2.5.1.18) (A)
MPTLYHHPMSSASRFVRLILSEYGYQTELSEEQPWENRRDFLALNPAGTLPVYVDDSMRA
LCGATIISEYLDETSGIMKRDRRLLAEDPFQRAEIRRLTEWFLQKMEADVTRPLVRERIF
KLQMTPDQGGGAPDSKVLRTSRSNIRQHMKYLSWLAGSRPWLAGDRISYADLAAAAATSV
LDYLGEIDWSDAPTAKEWYQRLKSRPSFRPLLAERVRGVTPVSHYADLDF

BLAST