GenomeNet

>sfh:SFHH103_06190 gst3; hypothetical protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MQLYYHPLSGHAHRARLLLSLLGLEHDLVLVDLARREHKQEPFLKLNPFGQVPVLDDGGT
IICDSNAILVYLAKTTGRTDWLPEEPQGAAAVQRWLSVAAGQIAHGPAQARLINVFKAPY
RPEEVIPRSHAILTLIEAALEGRGWIATDRPTIADVALYSYVARAPEGDVDLQPYANIRA
WLERIEALPGFVDFQKTPVGLDA

BLAST