GenomeNet

>sfr:Sfri_2158 Glutathione S-transferase, N-terminal domain protein; K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MIKFYFHPGPNPMKIALFLEETGLEFELVPVDTLKGEQHSAEFKAINPNSKTPAIEDNGV
RVFDSNAILLYLADKTGQLAATPENRGELLSWLMFVATGLGPYSGQCVHFTHHAPEKIDY
ATNRYLRETQRHYQVLDAHLNNREFIVGDELSIVDIAAWGWVDKVGYVLGQDALATYPNI
QRWFNSINNRPAVERARDMGKDIQFKAEFDEDAKRAFFPQNYAV

BLAST