GenomeNet

>sfu:Sfum_2533 type II site-specific deoxyribonuclease; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MRKKDNIESALEILAALGLPRAQQNERSALCLLALLNLIPGKAWAHSENPLIGITPMMKF
SGKYYGREYAPNTRETFRRQTIHQFLQAGVACYNPDRPDRPVNSPKAVYQISPEALALLK
TYGTNKWRAFLKRFLAIRKTLAQRYANERVQKLISVRVAVDQKIRISPGEHSELIKAIIE
SFAPRHAPGCRLVYVGDTGEKWGYFDEKLLADLGVTIDSHGKMPDVVLFYPEKHWLLLVE
SVTSHGPVDSKRHTELAVLFADSSAGLVYVTAFPSRAVMQRYLSEIAWETEVWIADAPSH
LIHFNGPRFLGPYDGKLGEKPKLADKGHLLPEYKTN

BLAST