GenomeNet

>sfu:Sfum_2795 thiamine pyrophosphate binding domain-containing protein; K00170 pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1] (A)
MGIAAEALKNFKGFNLKNMPEVEPVSPGHRACQGCGEVLALRQAMKALGTNVVVCSATGC
MEIITSPFPQTAWRVPWIHVAFENAAAVVSGVESAYKAMNRKNIIKSPDTVFVAYGGDGA
TADIGMQALSGALERGHNFIYMCFDNEAYMNTGVQRSSSTPFGAQTTTSPPGKKSKGQST
QKKNLPEIAVAHGTPYVATACPAFPVDLMNKVKKASLVPGPAYIHIYSPCPTGWRCGIEE
SVEMARLAVQSKVFPLYEVIDGVYYLSRKVAKPKPVAEYFKPQRRFRHLTEADVQQIQAR
TDAEYDRLVAKCVVEVKEKKEKE

BLAST