GenomeNet

>sfu:Sfum_3498 anaerobic glycerol-3-phosphate dehydrogenase subunit B; K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] (A)
MKSRPDSRLDLIVIGGGLAGTAAACLATTRGLSVARVAANAGGLAFAGGPLDLLGVYPPR
EQMVRDDPWEGISALIEGSPRHPYAVLGVDAVRRAMGEFLAFADSAGLRYCGMAERNVTI
ATAVGTLKTAYRVPRSMWRGVTALQDRLPTLIVDFEGMKDFSAAAMVEVLRSRWPRLQAL
RVTFPVRFPGIDRHNPLLAEALESSEIRAKLAEAIRPHLSGVLMVGMPAVLGIRAGDRVV
ADLEERLGVGIFEIPTMPPSVPGIRLQSAMEEALRKRGVQIFDGRRVLCARTEERLCAGI
TVGGAGEWHETMEAQGIILATGRFLGGGLSASRDGISEALFGLPVVQPPSRDRWHRGSFL
DPRGHPVNEAGLAIDDRFRPLGEDGSFAFENVFAAGSILAHQDWVRTKSGAGLAVSTAHG
AVEGFLRYRSGK

BLAST