GenomeNet

>sgc:A964_1791 neu1; sialidase domain-containing protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MVIVLGDSDSQEKLSSPLKAEIATEENRKQANLAELNVTQADNRTTYIIPESSHSIAEQQ
RFLIESKGSSVALLNSAEFRKTAGEDRGFERDKLRSLDIIPKGDLSTSNVIGNTDIASQI
SLGFKKNAIQEHHLTKTFSQKDGKLSSVIEGMLAIGKEKVEKEIKYSGNLWQKLKAKAHC
LVCCVDNLNFEDIKSYFQYYCHLNHQLKLPKGAILSAKTEVYRGGDFGRKNKDNVFGYRI
PSLLKTEKGTLLAGADERIEQACDWGNIGMVIRRSEDDGVTWGKRETIVNLRNNPRVPLV
TSGDYSGSPINMDMALVQDTSSKTKRIFSIYDMFPEGRGVISIANTPEKEYTQIGGQSYL
NLYNNGKKSKVFTIRDKGIVYNFKGKKTDYHVITETTKSDHSNLGDIYKGKQLLGNIYFT
KHKTSPFRLAKSSYVWMSYSDDDGRTWSSPRDITASLRQRGMKFLGIGPGKGIVLKWGPH
AGRIIIPAYSTNWKSHLRGSQSSRLIYSDDHGKTWHTGKAVNDNRILSNGEKIHSLTMDN
KKEQNTESVPVQLKNGDIKLFMRNLTGNLEVATSKDGGETWQNHVKRYKEIHDAYVQLSA
IRFEHDKKEYILLVNANGPGKKRQDGYARLAQVNRNGSFKWLYHHHIQDGSFAYNSVQQL
NNDQFGVLYEHREKHQNSFTLNYKVFNWSFLSQNTEKQGTLWEKMAANWHVLFKFYL

BLAST