GenomeNet

>sgp:SpiGrapes_3214 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) ATP-grasp enzyme, D-alanine-D-alanine ligase (A)
MHVALLYGGRSSEHNVSIKSAQNIYTILKKLGHAVLPIGISLSGTFHLQEDKPIQETIDQ
RQNVTVLPGLGFSCNNNLLPIEVAFPVTHGMGGEDGNLQGLCFLAQIPLCGCDTVSSALG
MHKELAQQLFASAGIPTVPTLSLNANAIAWLKEVEGASLPAFLGEHFFCSTCTTRIEIAL
PRILKQLGPSLLVKPENSGSSVGVTALKTPTGETLLSAIAYAAKFSECVLLQRLIEPMVE
IECAVLTTQDKGLLVAGPGLVIDPAKQNAGFLTYAHKYGQIDTAHMQIPSTLDGETEKTI
RDYAKKAFLSIKGDGYARVDFFFSDGLLYINEINTLPGMTATSHYPVLMQSCGYSLEQVV
QTLLDHTILRAQEEKGRTYVPPGI

BLAST