GenomeNet

>sgr:SGR_1023 conserved hypothetical protein (A)
MGAAVELDAGGRAVRLSNPDKVYFPQKGYTKRDVAEYFLAVGPGITRALNHRPTTLQRFV
DGVEGDFFYQKRAPKNLPEWIPTARIAFPSGRPADEICPTELAAVIWAANLGTLTFHPWP
VRAGDTDHPDELRIDLDPQPGTDYADAVTAAHELRSVLEDHGVRGWPKTSGGRGMHVFVP
IEPAWTFVEVRRAAIAAGRELERRMPERVTTAWWKEERGERIFVDFNQTARDRTIASAYS
VRPFPHAPVSAPLRWEEIDDAEPRDFDIRTLPVRYAELGDVHADMDQEAFRLDALLESAD
RDERERGLGDMPYPPEYPKMPGEPKRVQPSRARHDENDDGDGGAA

BLAST