GenomeNet

>sgr:SGR_6488 hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MEIDGAPRPAFVVQIHDARRLHFDFRLEVDGVLKSWAVPRGPSENPSDRRLAVPTEDHAL
EYREFEGVIPRGESGSGTVIVWDQGTYRPLGHDGSGDAVPFSESLALGHATFWLYGSKLH
GEFALTRVRKGDEPDSGGHEAWLLIKANDRLAVRGGPGSPDPYHARSARTGRTLHQVAAA
ASRGPGG

BLAST