GenomeNet

>sgr:SGR_6488 hypothetical protein (A)
MEIDGAPRPAFVVQIHDARRLHFDFRLEVDGVLKSWAVPRGPSENPSDRRLAVPTEDHAL
EYREFEGVIPRGESGSGTVIVWDQGTYRPLGHDGSGDAVPFSESLALGHATFWLYGSKLH
GEFALTRVRKGDEPDSGGHEAWLLIKANDRLAVRGGPGSPDPYHARSARTGRTLHQVAAA
ASRGPGG

BLAST