GenomeNet

>sgy:Sgly_0962 ATP-dependent DNA ligase subunit LigD; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MDRKLNDYNEKRNFARTTEPEGAREMAREGLRFVVQHHLARRDHYDFRLEWDGALLSWAV
PKGPSYNTRDKRLAVQVEDHPLEYRNFEGTIPKGEYGGGVVMLWDEGYWEPDGNVDDGLR
AGMLKFVLKGRRLKGKWALVRLKKKAGETKDNWLLLKEKDQYAKTGDEVSQFATSIRTGR
TMKEIEEGEDEKITPNPFGSTGVQLAKLVRMVPEGEDWLYELKYDGYRIVAYMEGGSARL
LTRNGRDYTARFPDVASSLSDWAGGRAMILDGEMAVTDAAGRTDFQALQNYLNNAQAQSL
TYIIFDLLALDGADLRGHRLLDRKGTLEALLKDAPENLYYSRHVSGNGRESFAAACAAGL
EGIIGKKADSLYSGTRNGDWIKLKCEQRQEFVIGGYTLSAKKTSGVSSLLLGVYEGQGLV
YAGRAGTGLSEAGRRELAEKFAGRERTEPPFRLPPKARANEKITWLEPELVAEIKFAEWT
KDDLLRQASFKGLRTDKKPEEIKREKTDGERQPPPSAKETERAMEANTNSIMIEGIKITN
PDKVIFTDPETTKGDVVRYYAQVAERMLPYVSRRVLSIVRCPKGIAQTCFYKKHPGPGSK
GIVTIPVTNSDGETEEYFYIENTSGLIAEAQMGTLEFHTWGSRADELEKPDLMVFDLDPD
EGMDLSRVRQGVRDMKDLLTELSLRAYLKTSGGKGYHVVVPLKPSVSWDRFYDFARRVAE
VMEQKWPDRYTSNVRKAKRAGKIFIDWMRNGRGATSIAPYSLRAREGTRVSMPIAWEELD
TVAPDSVNMAEALRRIGGNDPWQGFFRNGQQLK

BLAST