GenomeNet

>sha:SH0913 hypothetical protein; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MMRNYTQQYINGEWIDSDSNETIEVINPATEEVIGKVAKGNSNDVEKAVEAANNVYLEFR
HSSVKERKELLDKIVEEYKNRKQDIIEAITDELGAPLTLSENVHYQMGLNHFEEASRALD
SFEFEERRGDALVTKEAIGVSGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAA
VILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGRTGSKIMEKASKDF
KKVSLELGGKSPYIVLDDVDVKEAAKATTGKVVNNTGQVCTAGTRILIPESKKEDFLTAL
KEEFSKVKVGDPREEGTQVGPIISKKQFDTVQSYIDKGIEEGAELFYGGPGKPEGLNTGY
FARPTIFINVDNDMTIAQEEIFGPVASVITYNNLDEAIKIANDTKYGLAGYVIGKDKETL
QKVARSIEAGRIEINEAGNQPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYFS

BLAST