GenomeNet

>sha:SH0913 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (GenBank) unnamed protein product; hypothetical protein, similar to aldehyde dehydrogenase (A)
MMRNYTQQYINGEWIDSDSNETIEVINPATEEVIGKVAKGNSNDVEKAVEAANNVYLEFR
HSSVKERKELLDKIVEEYKNRKQDIIEAITDELGAPLTLSENVHYQMGLNHFEEASRALD
SFEFEERRGDALVTKEAIGVSGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAA
VILAEIFDKVGVPKGVFNLVNGDGEGVGNPLSEHPKVRMMSFTGSGRTGSKIMEKASKDF
KKVSLELGGKSPYIVLDDVDVKEAAKATTGKVVNNTGQVCTAGTRILIPESKKEDFLTAL
KEEFSKVKVGDPREEGTQVGPIISKKQFDTVQSYIDKGIEEGAELFYGGPGKPEGLNTGY
FARPTIFINVDNDMTIAQEEIFGPVASVITYNNLDEAIKIANDTKYGLAGYVIGKDKETL
QKVARSIEAGRIEINEAGNQPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYFS

BLAST