GenomeNet

>shb:SU5_02879 Anaerobic glycerol-3-phosphate dehydrogenase subunit A (EC:1.1.5.3); K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MKTRDSQTSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDDLAFQATFIRACEAAGIRAEA
IDPQQARIIEPSVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGAIVLTAHEVTGLIRE
GATVCGVHVRNHLTGETQTLHAPVVVNAAGIWGQRIAEYADLSIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGLEGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCITADTPLPGSKESTEHTLKRIISLPAPLRGSAVYRHGDRTP
GWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTAAQSITQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEHQD
EI

BLAST