GenomeNet

>shc:Shell_1213 ATP-grasp domain-containing protein; K01905 acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13] (A)
MNPREIIQKAYEEKRRKLLEHEAFEIIKAYNISAPETAIARSLDEAVEYAEKIGYPLVLK
IVSPDISHKSDVGGVILNIKSKEELIEAYNKIYENVSKNAPGARIVGVLIQKMAPKGLEV
IIGGLRDNIFGPVVMFGLGGIFVEVLRDVSFRIAPLTEEDAFEMMNEIKAAKLLEGYRGQ
PPVDKKSLAKIILSVSKLLEENPEIESIDLNPVMAYPDNAVVVDARIILKT

BLAST