GenomeNet

>shc:Shell_1213 K22224 acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13] | (GenBank) ATP-grasp domain protein (A)
MNPREIIQKAYEEKRRKLLEHEAFEIIKAYNISAPETAIARSLDEAVEYAEKIGYPLVLK
IVSPDISHKSDVGGVILNIKSKEELIEAYNKIYENVSKNAPGARIVGVLIQKMAPKGLEV
IIGGLRDNIFGPVVMFGLGGIFVEVLRDVSFRIAPLTEEDAFEMMNEIKAAKLLEGYRGQ
PPVDKKSLAKIILSVSKLLEENPEIESIDLNPVMAYPDNAVVVDARIILKT

BLAST