GenomeNet

>shg:Sph21_5174 glycosyl hydrolase BNR repeat-containing protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MSIYKISLLIYVFGIFFHLSMAKPVIQIEQTQFQVPILIGKPVNPVLRIKITIEGTKPHQ
LKALSLQTQGTTAIQDLNTVEVYYTGKDTLLNKMSTALKLFGKKANPKANITLEGDTELN
PGIHYLWVTCRLTDQANLLHKIAFQLEDVHFNESTDVRITDRPIMEQRIGIAIHQRMENG
IHTARIPGLAVTPKGTLLAIFDARRESSRDLQGDIDIGLRRSTNGGQTWEPLTIAMDMGK
WGGLPEKFNGVSDACILVDKNSNTIYIAALWMHGIIDKDGQWVKGLKENSDHWNHQWKNK
GSQPGFGIKQTSQFMLVKSTDDGKTWSKPLNITKMCKKKDWWLFAPAPGNGIVLNDGTLV
FPTQGRDSLGTPFSTITYSKDSGKTWQTAKRALNEVATTECAVVQLADRSLMLNMRANKN
KGEIGSNNGRAVCVTRDMGKTWTQHPSAFHALPEPVCMASLYKHSFMDAGKQRHLLLFSN
PNSKTDRDHLTIKVSTNDGQTWPQKYWVLLDEWKGRGYSCIAAVDEQHIGILYESSQADM
VFQKIAVSEWPEK

BLAST