GenomeNet

>shl:Shal_2941 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MAQLYFYYSAMNAGKSTSLLQSSYNYRERGMHTLVMTASIDDRYGVGKVASRLGIETEAQ
VFGSNDNLTQMISTSHADKTLHCILIDESQFLSKEQVKQLTYVVDILDIPVLCYGLKTDF
QGELFSGSHYLLAWADKLVELKTICHCGRKANMVVRLDGDGKPMREGEQVAIGGNESYES
VCRKHFREFIWD

BLAST