GenomeNet

>shr:100918271 K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] | (RefSeq) SETMAR; SET domain without mariner transposase fusion (A)
MSEEQPGASLGGQRDVGRGLENLPVSSWPEGEEPEFQYTPEHVIGPGAEVDPTQITFPGC
TCLTTSCLPTICSCLLHGENYDNLCLRDIEGKMEFARPVFECNVMCQCSEQCKNRVVQRG
LQFNLQVFKTDKKGWGLRTLEFIPKGRFVCEYAGEILGSSEARRRIQQQTKHDSNYIIAI
REHICDGQIIETFVDPTNIGNIGRFLNHSCEPNLLMIPVRVDSMVPRLALFAAKDILPKE
ELSYDYSGRFRNFTKNDRNQEIPDKDKMGKPCYCATKSCAAFLPYDSSLYSPLEKQTTN

BLAST