GenomeNet

>shr:100922258 K11419 histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43] | (RefSeq) SUV39H1; histone-lysine N-methyltransferase SUV39H1 isoform X1 (A)
MCRVAKLCCHDLGITKKNMCIFEVDYLCNYKKIDDKEYYLVKWKGYPKSENTWEPRRNLR
CAATLKQFHRDLEGELFRRSRRRPRVWPPRHLDAAILSFLEQKGEQRKALRRWEKELNLA
RAHKGSIAVENEVDLFWPPEDFTYINEYRVTEGITLDQVTTGCRCKNCLESPVNGCCPGT
NLNRFAYNIQGQVRLEAGQPIYECNSHCLCDMQCANRVVQRGTYYNLCIFRTDNGRGWGV
RTQEKIRCHTFVMEYVGEIITSEEAERRGRVYDRQGITYLFDLDYVEDVYTVDAAHFGNI
SHFINHSCCPNLQVYNVFVDNLDQRLPRIAFFATRTIRAGEELTFDYNMQGSPKKRVRIA
CKCGAEFCRKYLF

BLAST