GenomeNet

>shr:100928904 K11421 histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43] | (RefSeq) SETDB1; SET domain bifurcated 1 (A)
MTSFPGCFGLGAAAAGMEPQEIAELQQAVVEELGISMEELRQFIDEELEKMDCVKQRKRQ
LAELESWVVQKETEVAHVDELFDEASRAVTNCETLVKDFYSKLGLQYRESSSEDEASKPT
EVIEIPDEDDDVLSVDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKTSSQDL
NKGALGQVPVELSKDGDLVVSMRILGKKRTKTWHKGTLIAIQTVGAGRKFKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTLEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTGTGTQFKPLEPPRTPSLPAPTLSPQVADLESLESQLAQAR
KQVAKKSTSFRLGSVGSGHSSPTSPGLNEAVPGGKSAVGQTVRLTPGSATPGPTFPAFHG
MLERAPAEPSYRAPMEKLFYLPHACSHTCLTRVRPVSNAQYRGKNPLLVPLLYDFRRMTA
RRRVNRKMGFHVIYKTPCGLCLRTMNEIERYLFETSCDFLFLEMFCLDPYVLVDRKFQPY
KPFYYILDITHGQEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGWEFLVGCDCKD
GCRDKSKCACHQLTIQATACTPGGQINPNSGYQHKRLDECLPTGVYECNKRCKCNINMCT
NRLVQHGLQVRLQLFKTQNKGWGIRCLDDIARGSFVCIYAGKILTDDFADKEGLEMGDEY
FANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNFCKD
EDFSTSSVWRSYATRRQTRGQKENGTSETASKDSRPTDSGTPHLSAPQTSMGGCKPPSSE
DTPKNKVATWLSCNNVSDSSFADSDSRSSFRTSEGGDGRAGVGRGDGEKPSVSGLGVKEE
GDIKAPKKEESDEQSKIVLSSEGSRTFGYNPSPLKTEGIKGPPSKTNIHQARRLVAPAQA
NPDDVLTLSSSTESEGESGTSRKPVAGQAPATAADSDDIQTISSGSDGEDYEDKKNLSGP
IKRQVAVKSTRGFALKSTHGIAIKSTNMASADKGESVPVRKNTRQFYDGEESCYIIDAKL
EGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEG
KELLCCCGAIECRGRLL

BLAST