GenomeNet

>shr:100928904 SETDB1; SET domain, bifurcated 1; K11421 histone-lysine N-methyltransferase SETDB [EC:2.1.1.43] (A)
MTSFPGCFGLGAAAAGMEPQEIAELQQAVVEELGISMEELRQFIDEELEKMDCVKQRKRQ
LAELESWVVQKETEVAHVDELFDEASRAVTNCETLVKDFYSKLGLQYRESSSEDEASKPT
EVIEIPDEDDDVLSVDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKTSSQDL
NKGALGQVPVELSKDGDLVVSMRILGKKRTKTWHKGTLIAIQTVGAGRKFKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTLEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTGTGTQFKPLEPPRTPSLPAPTLSPQVADLESLESQLAQAR
KQVAKKSTSFRLGSVGSGHSSPTSPGLNEAVPGGKSAVGQTVRLTPGSATPGPTFPAFHG
MLERAPAEPSYRAPMEKLFYLPHACSHTCLTRVRPVSNAQYRGKNPLLVPLLYDFRRMTA
RRRVNRKMGFHVIYKTPCGLCLRTMNEIERYLFETSCDFLFLEMFCLDPYVLVDRKFQPY
KPFYYILDITHGQEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGWEFLVGCDCKD
GCRDKSKCACHQLTIQATACTPGGQINPNSGYQHKRLDECLPTGVYECNKRCKCNINMCT
NRLVQHGLQVRLQLFKTQNKGWGIRCLDDIARGSFVCIYAGKILTDDFADKEGLEMGDEY
FANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNFCKD
EDFSTSSVWRSYATRRQTRGQKENGTSETASKDSRPTDSGTPHLSAPQTSMGGCKPPSSE
DTPKNKVATWLSCNNVSDSSFADSDSRSSFRTSEGGDGRAGVGRGDGEKPSVSGLGVKEE
GDIKAPKKEESDEQSKIVLSSEGSRTFGYNPSPLKTEGIKGPPSKTNIHQARRLVAPAQA
NPDDVLTLSSSTESEGESGTSRKPVAGQAPATAADSDDIQTISSGSDGEDYEDKKNLSGP
IKRQVAVKSTRGFALKSTHGIAIKSTNMASADKGESVPVRKNTRQFYDGEESCYIIDAKL
EGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEG
KELLCCCGAIECRGRLL

BLAST