GenomeNet

>shr:100931806 SDHA; succinate dehydrogenase complex, subunit A, flavoprotein (Fp); K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MKHNYHSHDYHHHHHHYHHHQAFIRRLFIQGIGMGTVQNRIPSPVPALLEFTLEIHLNAI
LLVFIQWPATLQSSTRKFHFTVSGEKKSSAKISNSISTEYPVVDHEFDAVVVGAGGAGLR
AAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGD
QDAIHYMTEQAPASVVELENYGMPFSRTEEGKIYQRAFGGQSLKFGKGGQAHRCCCVADR
TGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCIEDGSIHRIRAKNTVIA
TGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEG
GILINSQGERFMERYAPVAKDLASRDVVSRSMTVEIREGRGCGPEKDHVYLQLHHLPPEQ
LASRLPGISETAMIFAGVDVNKEPIPVLPTVHYNMGGIPTNYKGQVLKHVNGTDQIVPGL
YACGEAASASVHGANRLGANSLLDLVVFGRACALSIAETCKPGDKVPQIKSNAGEESVAN
LDKLRFASGNIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCQKISQLYNDLKDLKTFDRG
MVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPLEGQQK
RPFAEHWRKHTLSYVDIKTGKVSLEYRPVIDKTLNEADCATVPPAIRSY

BLAST