GenomeNet

>shr:100932535 K17451 histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43] | (RefSeq) EZH1; enhancer of zeste 1 polycomb repressive complex 2 subunit (A)
MSKKTEDQRGKVACPKLNSKMDIPNSPTSKCITYWKRKVKSEYMRLRQLKRFQANMGAKA
LFVANFAKVQEKTQILNEDWKKLRIQPVQLMKPVSGHPFLKKCTVESNFPGFDSQDMLMR
SLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHG
EEEMIPGSVLISDAVFLELVDALNQYSDEEEDGHNNDSSEGKQEDSKEELPVLRKRKRLT
IEGNKKSSKKQFPNDMIFSAISSMFPENGVPDDMKERYRELTEVSDPNVLPPQCTPNIDG
PCAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIRIEPDPCGLDCFL
WLEGAKEYAMLHNPRSKCSGRRRRRHQVVNASSSNTSTSAVTETKEGDSDRDTGNDWASS
SSEANSRCQTPTKQKASPAPPQLCVVEAPLEPVEWTGAEESLFRVFHGTYFNNFCSIARL
LGTKTCKQVFQFAVKESLILKLPTNELMNPSQKKKRKHRLWAAHCRKIQLKKDNSATQVY
NYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVR
ECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFI
SEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAK
VVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL

BLAST