GenomeNet

>shr:100933547 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) KMT5A; N-lysine methyltransferase KMT5A isoform X1 (A)
MGQSKIYSYMSPHRSSGTRPPLQEENSVAHHDVKCQGKALTELHKKGEEKRIGINAPAST
MKSEEQKGKELRRDSLEPLPNHKSIAVGNPKAMTLPANAADAAGAKHAPKKPPKTKQASR
RNLRPFGYLGSGELAHFKASLLPGGNIGPGSALPAWGRTILQKPSLPSSHNNSVRAQGKT
QQNRKVTDYYPVRRSSRKSKAELQSEEKRKLDELIESGKEEGMKIDIIDGKGRGVIATKQ
FTRGEFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETDRLGR
LINHSKCGNCQTKLHDIDGVPHLILIASRDIKAGEELLYDYGDRSKASLEAHPWLKH

BLAST