GenomeNet

>shw:Sputw3181_0712 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase, N-terminal domain (A)
MKLLCSQASPYARCVRTLIRYLNIKDIEEVTVNPFENTAELLDANPLGQIPCLITNDGIP
LYDSEVIMRYLDAELGEQHMFGVPNSHWVLQCQFSMIKGLIDSAVKLRQEQMREDEGLRS
VFWTSRFEQALLRGLMQMEHQSVITQATVQAPQLALICLLDYMDFRHPELDWRKVAPATA
LWFSDMRDLPAFVETRPH

BLAST