GenomeNet

>shw:Sputw3181_0712 Glutathione S-transferase, N-terminal domain; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKLLCSQASPYARCVRTLIRYLNIKDIEEVTVNPFENTAELLDANPLGQIPCLITNDGIP
LYDSEVIMRYLDAELGEQHMFGVPNSHWVLQCQFSMIKGLIDSAVKLRQEQMREDEGLRS
VFWTSRFEQALLRGLMQMEHQSVITQATVQAPQLALICLLDYMDFRHPELDWRKVAPATA
LWFSDMRDLPAFVETRPH

BLAST