GenomeNet

>shy:SHJG_2075 hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MAAEDRLRTYRGKRDFERTREPSGRTRRTRGARPRFVVQIHDARRMHFDFRLQVDDVLKS
WSVPKGPSTDPGDKRLAVPTEDHPLEYEEFEGVIPKGEYGGGTVIVWDRGTYEPLSHDRR
GRPVDFAESLERGHATFRLHGAKLHGEYALTRFRGGTDGEEAWLLVRKGPARPDGHGTPD
PRRARSVRSGRTLAQVAAAAGRE

BLAST