GenomeNet

>shy:SHJG_2075 no KO assigned | (GenBank) hypothetical protein (A)
MAAEDRLRTYRGKRDFERTREPSGRTRRTRGARPRFVVQIHDARRMHFDFRLQVDDVLKS
WSVPKGPSTDPGDKRLAVPTEDHPLEYEEFEGVIPKGEYGGGTVIVWDRGTYEPLSHDRR
GRPVDFAESLERGHATFRLHGAKLHGEYALTRFRGGTDGEEAWLLVRKGPARPDGHGTPD
PRRARSVRSGRTLAQVAAAAGRE

BLAST