GenomeNet

>shy:SHJG_2075 hypothetical protein (A)
MAAEDRLRTYRGKRDFERTREPSGRTRRTRGARPRFVVQIHDARRMHFDFRLQVDDVLKS
WSVPKGPSTDPGDKRLAVPTEDHPLEYEEFEGVIPKGEYGGGTVIVWDRGTYEPLSHDRR
GRPVDFAESLERGHATFRLHGAKLHGEYALTRFRGGTDGEEAWLLVRKGPARPDGHGTPD
PRRARSVRSGRTLAQVAAAAGRE

BLAST