GenomeNet

>shy:SHJG_5257 branched-chain alpha-keto acid dehydrogenase E2 subunit; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MTTMTEASVREFKMPDVGEGLTEAEILKWYVQPGDTVTDGQVVCEVETAKAAVELPIPYD
GVVRELHFPEGTTVDVGTPIIAVAVAGAGGAAPKAPAEQPAAAPAPAKDEPKPEGRQPVL
VGYGVAASSTRRRPRKGPEVTVPAPAQAVQAELNGHGGAVAGKSRPLAKPPVRKLAKDLG
VDLAAITPSGPDGIITREDVHAAATPRTAEPAAPVTAAPAAPAAPAPVASYDTAREIRIP
VKGVRKATAQAMVGSAFTAPHVTEFVTVDVTRTMKLVEELKQDKEMQGLRVNPLLLIAKA
LLVAIKRNPDINASWDEANQEIVRKRYVNLGIAAATPRGLIVPNIKDAQDKTLPELAQAL
GELVSTAREGKTSPAAMQGGTVTITNVGVFGVDTGTPILNPGESAILAVGAIKLQPWVHK
GKVKPRQVTTLALSFDHRLVDGELGSKVLADVAAVLEQPKRLITWA

BLAST