GenomeNet

>sib:SIR_0015 nanA; neuraminidase A protein (EC:3.2.1.18); K01186 sialidase-1 [EC:3.2.1.18] (A)
MNWSFFNWKKQDKIRKLVVGATFIVIGIAIFLALSGLKQVNTVLANTKKVESGINNSIAD
LLKETNVIPRDYYARQLENVQTIFEKENVVTNDSNNQRIDLSGELDKLKQLQTATIHIEF
KADANAPRFYNLFSVSSDKVKNEYFTMAVYNNTAIVEGRDKDGKQFYNSYNDAPLKIKSG
QWNSVTFTVDGPNSDHPNGQVRLYVNGVLSRTSKLSGRFIKDMPDVNHVQIGKTNRARSM
MWGSNLHVRNLTVYNRALTSEEVQKRSQLFKRSDLEKRLPEGALLTEKTDVFKSGYNNQP
NSEGINSYRIPALLRTDKGTLIAGADQRRLHHADYGDIGMVVRRSEDNGKTWGDKKVLSN
LRDNPDAKDPVAPSPLNIDMTLVQDPTTKRIFAIYDMFPEGKGIFGMPKNNEKAYEQVGD
KTYQILYKQGEFGHYTIRENGEVYDANNQKTDYRVVVNPTKADYRDKGDIYKGQELVGNI
YFAQSKKNPFRIAYTSYLWMSYSDDDGKTWSAPRDITSGVRKDWMKFLGTGPGTGIVLRT
GKHKGRILIPVYTTNNVSHLNGSQSSRLIYSDDHGETWHAGEAVNDNRQVGGQKIHSSTM
NNRNAQNTESTVVQLNNGDIKLFMRGLTGDLQVATSKDGGATWEKEIKRYPQVKDVYVQM
SAIHTMHDGIEYVVLSNAGGPERTNGLVHLARVEKNGELTWLKHNLIQKGEFAYNSLQDL
GNGEYGLFYEHRENGQNPYTLSYKKFNWDFLSKDLISPKEVKVKKAVDRGKGVVGLEFDS
EVLVNQAPTLELTNGKIATFITQYDSKTLLFKVDKGAIGQKITGLASGSIESIHNLPVNL
TGASIPGGVNGGEGTVNEVPEYKEKKSTKKPATEKKQANKVLTNHHNLPSTGSTTNVPVL
FLGIATIILGLLTMINKRKQ

BLAST