GenomeNet

>sic:SiL_0068 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) Uncharacterized protein conserved in archaea (A)
MSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTHVVRKLLS
NYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYGNGITVPV
FEVILPMTTSNLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEVIPLVEDR
DSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYKLSESLNF
EIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSAISSINNS
RIGPAKILEKYEEDVLRKITILYTERYQPIIESLANAINDVSMLLPRRRARKLHIGLFGY
SRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFKHDLQTAA
RFFNWESFELIKDIWKISEDTIAKIKEDIDYAESVIGIKLGDIDYDSRKHILMSSLFLLS
FKEKILQESKKYLYEMALIRRSLG

BLAST