GenomeNet

>sie:SCIM_1563 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) conserved hypothetical protein (A)
MRFKFCYNYLMHNTYYFIRHAHSNYTPDEINRPLSDKGRESLAQIEFLADKPITAIYSSP
YRRAIQTVEPLAQSLKLAIQTDKRLIERKLSSQAIADQDFEQCLMQLWSQPTFSLVGGES
NQQAQQRALALLHELESKHQNEEIIISSHGNLICILLSAFDSSIDYNFWCGLSMPDVLVL
DKDEKITHLL

BLAST