GenomeNet

>sii:LD85_0069 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) protein of unknown function DUF557 (A)
MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTH
VVRKLLSNYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYG
NGITVPVFEVILPMTTSNLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEV
IPLVEERDSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYK
LSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSA
ISSINNSRIGPAKILEKYEEDVLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKL
HIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFK
HDLQTAARFFNWESFELIKDIWKISEDTIAKIKEDIDYAESVIGIKLGGIDYDSRKHILM
SSLFLLSFKEKILQESKKYLYEMALIRRSLG

BLAST