GenomeNet

>sim:M1627_2723 hypothetical protein; K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MYSLNPSNPTFFDSDKLLSEFIRQASVCHGCRLCFNYCDSFPLMFTYTDKKGPKNLTLDD
LFNVASKCFHCKMCYVNCPYVPPHEFNMDFPSLMEWAWLYYKKKRGLTVRDFIFEMLDGV
KFARPLAKVIMEKNKELLGIHKEAPTLPVAEKGLRERVKQRIIDNPKAKVALFPTCLIEN
FFPEIGEDLIELYNELGIEVIIPNFVCCGAPMLDSGDVDRLKKNAEYNTKIIEDLVKKGY
DVVSPIPTCTLMIREYKKILDNEIPKVYDAMEYLFKLKNEGKIELKGKIEKNVYYHPPCH
LKFLQVGLPGVRLLRSMGAKVDISNNGCSGIDGGWGLRNYDTAKRVGSKMMEAFKQSKAD
LFSTECPLAGLQIEKSSGRRPLHPIQLLKEAMKNG

BLAST